PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G02160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 302aa    MW: 32528.4 Da    PI: 5.2561
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G02160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092352682255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  OGLUM05G02160.1 235 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 268
                      59*****************************885 PP

2ELK33.21.2e-11188209122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK++Ll+KYsg+L+ L++EF+
  OGLUM05G02160.1 188 ELKEMLLKKYSGCLSRLRSEFL 209
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-185397IPR005540KNOX1
PfamPF037901.6E-195594IPR005540KNOX1
SMARTSM012564.0E-27102153IPR005541KNOX2
PfamPF037912.7E-23106152IPR005541KNOX2
SMARTSM011883.6E-6188209IPR005539ELK domain
PROSITE profilePS5121310.423188208IPR005539ELK domain
PfamPF037891.4E-8188209IPR005539ELK domain
PROSITE profilePS5007112.681208271IPR001356Homeobox domain
SMARTSM003892.5E-14210275IPR001356Homeobox domain
SuperFamilySSF466898.13E-20210279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-27213273IPR009057Homeodomain-like
CDDcd000863.22E-13220272No hitNo description
PfamPF059205.0E-17228267IPR008422Homeobox KN domain
PROSITE patternPS000270246269IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEDLYSIHPG ISRGGGGGGG GAASEASGVA GGGSSPPHPP PPATTAAAAD LTELMKAQIA  60
GHPSYPSLLS AYIECRKVGA PPEVTTLLEE IGREGRGGGA TAGGEIGLDP ELDEFMETYC  120
RVLERYKEEL TRPFDEAASF LTGIHTQLAS LCGGAPPPTD NSEDEPCSGD ADAADFGQEH  180
SSRLADHELK EMLLKKYSGC LSRLRSEFLK KRKKGKLPKD ARSALMDWWN THYRWPYPTE  240
EDKVRLAAMT GLDPKQINNW FINQRKRHWK PSEDMRFALM EGVTGGSSSG TTLYFDTGTI  300
GP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212LRSEFLKKRK
2209213KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288850.0AB028885.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH71, complete cds.
GenBankAF0501800.0AF050180.1 Oryza sativa strain Indica IR58 KNOX class homeodomain protein (Oskn2) mRNA, complete cds.
GenBankAK1118780.0AK111878.1 Oryza sativa Japonica Group cDNA clone:J033046I12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637898.11e-166PREDICTED: homeobox protein knotted-1-like 10
SwissprotQ7GDL51e-168KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
SwissprotA2Y0071e-168KNOSA_ORYSI; Homeobox protein knotted-1-like 10
TrEMBLA0A0D9ZTS10.0A0A0D9ZTS1_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g03884.11e-166(Oryza sativa Japonica Group)
STRINGBGIOSGA018883-PA1e-166(Oryza sativa Indica Group)
STRINGORGLA05G0020500.11e-166(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-74KNOTTED1-like homeobox gene 6